SKU: 20901013839

SARS-CoV-2 (BA.4&BA.5/Omicron) RBD, His Tag

Sale price$63.00 Regular price$70.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SARS-CoV-2 (BA.4&BA.5/Omicron) RBD, His TagProduct Specification Species SARS CoV 2 Accession P0DTC2 Amino Acid Sequence RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 35 kDa Purity >95% Endotoxin <0. 1EU g Conjugation Unconjugated Physical Appearance Lyophilized

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence

RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 35 kDa
Purity >95%
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Background

Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20901013839

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1715 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
NMBecaBoo
Los Angeles, US
★★★★★ 5
Taste of summer
Flavor Name: Coconut, Size: 25.4 Fl Oz (Pack of 1)
This is so coconutty and perfect! We keep this in the house to spice up our sprites, or even add to mixed adult beverages. It is sweet - but it is supposed to be.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
R
Verified Purchase
❤️RAWR-RAWR❤️
West Palm Beach, US
★★★★★ 5
⭐ DaVinci Gourmet Classic White Chocolate Syrup Review
Flavor Name: White Chocolate, Size: 25.4 Fl Oz (Pack of 1)
The DaVinci Gourmet Classic White Chocolate Syrup is a must‑have if you love café‑style drinks at home. It delivers that rich, creamy white‑chocolate flavor without being overly sweet, and it blends beautifully into both hot and cold beverages. Whether you’re upgrading your morning latte or adding a touch of sweetness to desserts, this syrup is incredibly versatile and delicious. 🍫 Why This Syrup Stands Out Smooth white‑chocolate flavor: Creamy, mellow, and perfectly balanced — not artificial or overly sugary. Great for hot & iced drinks: Mixes easily into lattes, iced coffees, frappes, hot chocolate, and even milkshakes. Barista‑quality texture: Silky and consistent, making it easy to drizzle, blend, or layer. Large 25.4 oz bottle: Plenty of syrup for daily use, entertaining, or experimenting with new recipes. Versatile beyond drinks: Works beautifully in baking, frosting, oatmeal, and dessert toppings. ☕ Perfect For Homemade lattes and cappuccinos Iced coffees and cold brews White‑chocolate mochas Dessert drizzling Smoothies and milkshakes Holiday drinks and creative recipes It adds that cozy café sweetness without overpowering the drink. 🔍 Things to Keep in Mind Because it’s a classic syrup (not a sauce), the flavor is lighter and more mixable — great for drinks, but those wanting a thick drizzle may prefer a white‑chocolate sauce. A little goes a long way, so start with a small amount and adjust to taste. ⭐ Final Thoughts The DaVinci Gourmet Classic White Chocolate Syrup is a creamy, smooth, and incredibly versatile addition to any coffee or dessert routine. It elevates homemade drinks with a professional touch and adds just the right amount of sweetness. If you love white‑chocolate‑flavored coffees or want a reliable syrup for everyday use, this bottle is an excellent choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
M
Verified Purchase
⪨MIND ⪨⪨🎵⪩⪩ PRIME⪩
Port Orchard, US
★★★★★ 5
✪ DaVinci | Gourmet Classic Vanilla Syrup: Great Flavor, Uses Cane Sugar, Great Price...
Flavor Name: Vanilla, Size: 25.4 Fl Oz (Pack of 1)
✪ DaVinci | Gourmet Classic Vanilla Syrup, 25.4 fl. oz. (Pack of 1) _____________________________________________________________________> ♦♦ Vanilla Syrup: ● I wanted to reduce the amount of flavored coffee creamer that I normally use, so I thought I would give DaVinci syrups a try. This was the first time that I tried and used the DaVinci brand. ♦♦ Coffee Time: ● I used about half of the coffee creamer that I typically use and I added a teaspoon or two of DaVinci syrup to my morning coffee. I gave it a good stir, then took a few sips and there was plenty of flavor for my liking and it seemed to have a rounder and had more of a vanilla like taste when comparing it to the vanilla flavored coffee creamer that I normally use, I definitely enjoyed the result. ♦♦ Great for Other Uses: ● I also tried this syrup with other drinks such as soft drinks, cola, orange and root-beer, and a smoothie. All of them of them were very good, indeed. Give it a try. ● I also added some to plain yogurt and some other foods and they all tasted really good as well. ♦♦ Ingredients: Cane Sugar, Water, Natural Vanilla Extract with Other Natural Flavor, Sodium Benzoate and Potassium Sorbate (preservatives), Citric Acid, Caramel Color. ✪ Pricing: $6.88 / 25.4 fl. oz. ● A very affordable price for it's size, especially when compared to other brands that I've had before. ✪ SCORE: 5 Stars > ⭐ ⭐ ⭐ ⭐ ⭐ ♦ ✪ ♦ Over-All: ● I most definitely liked the results that I got when using DaVinci flavored syrup with my coffee, soft drinks (soda) and even food. As affordable as it is I would recommend checking it out and see what you can come up with. I would buy it again. ______________________________________________________________________>
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
N
Verified Purchase
Nicholas
Louisville, US
★★★★★ 4
Comparing to the coffee giant version
Flavor Name: Brown Sugar, Size: 25.4 Fl Oz (Pack of 1), Flavor Name: Brown Sugar, Size: 25.4 Fl Oz (Pack of 1)
Starbucks comparison (from a personal standpoint): I’m fortunate enough to have a bottle of Starbucks Brown Sugar. Problem is, I’m almost out. Looking around at some alternative options, and reading the reviews- I see some saying this is a good substitute. Because I happen to have the syrup on hand, I figured I should see if it is, because it would be great given the low cost of DaVinci syrup. This picture I’m attaching is just to see the color difference. Consistency wise, the DaVinci syrup is much lighter, more runny. The Starbucks is definitely a thicker liquid, that runs much slower. Flavor is the big one: DaVinci is lighter on taste, and sweeter. The best way to describe the flavor is comparing DaVinci’s to 100% real maple syrup that’s been diluted down with water. It’s good, but not really similar (in my opinion) to Starbucks Brown Sugar. Starbucks is more smokey in flavor, more strong/bold. My drinks are made using espresso, oak milk, cinnamon powder, and ice. I made my drink the same way, but used DaVinci Syrup this time. I found that the same amount of syrup that I use for the Starbucks, didn’t feel like it had a strong enough flavor. What did I do? I added an extra ounce of DaVinci hoping to get a stronger flavor. The problem is, DaVinci is more sweet than the Starbucks syrup (in my opinion) and ended up making my drink taste too sweet. It’s sweet enough that I’m not going to finish drinking it. I’m not knocking the DaVinci syrup itself. I think it’s a good brand and a good flavor. It’s just not the flavor I was hoping would solve my issue for a Starbucks imitation. I would encourage anyone to still try this syrup, but do so to enjoy it for being its own flavor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
M
Verified Purchase
Mona S
Cuba, US
★★★★★ 5
Tastes Like Banana Pudding and Dunkin Banana Flavor!
Flavor Name: Banana Bread, Size: 25.4 Fl Oz (Pack of 1)
I don't know why someone would buy this expecting it to taste like real bananas like come on ppl lol. The only way to attain a syrup that tastes like real banana bread is to make it at home. This is an artificially flavored syrup so obviously it tastes that way! I have made banana bread syrup (more like a sauce) at home and it is delicious, highly recommend!! But this is way more shelf stable and tastes amazing in an iced latte as well! Different than home made but still good. To me this tastes like banana pudding mix which also has a fake banana taste. It also tastes EXACTLY like the new Dunkin banana flavored syrup which is what I was looking for! I use 1.5 tbsp syrup, a little vanilla paste, 2 espresso shots and 2 percent milk with plenty of ice. I like keeping my latte calories below 200 and not super sweet tho so you can up it to 2 tbsp. The cals in this are not terrible, 70 cals for 2 tablespoons. Usually my syrups have 50-60 cals for only 1 tbsp so I'm pleasantly surprised this is a little lower. I bought a second bottle because I'm afraid this is a limited release lol.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026

recommand products